Allergen

C0HLQ0

Accession C0HLQ0
Species Juniperus ashei
Common Name mountain cedar
Description gibberellin-regulated protein
IUIS Name Jun a 7
Gi
Length 63
Year Adopted 2022
Sequence >C0HLQ0 Allergen Jun a 7; gibberellin-regulated protein [Juniperus ashei]
AQIDCDKECNRRCSKASAHDRCLKYCGICCKKCHCVPPGTAGNEDVCPCYANLKNSKGGH
KCP
Parent Accession