Allergen

C0HLQ2

Accession C0HLQ2
Species Cupressus sempervirens
Common Name Italian cypress
Description gibberellin-regulated protein, cypmaclein
IUIS Name Cup s 7
Gi
Length 63
Year Adopted 2022
Sequence >C0HLQ2 Allergen Cup s 7; gibberellin-regulated protein, cypmaclein [Cupressus sempervirens]
AQIDCDKECNRRCSKASAHDRCLKYCGICCEKCHCVPPGTAGNEDVCPCYANLKNSKGGH
KCP
Parent Accession