Allergen

CAA01909.1

Accession CAA01909.1
External DB Link NCBI Protein
Species Cynodon dactylon
Common Name Bermuda grass
Description calcium-binding protein, polcalcin
IUIS Name Cyn d 7
Length 71
Year Adopted 2007
Sequence >CAA01909.1 Cyn d 7; calcium-binding protein, polcalcin [Cynodon dactylon]
GTRRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEFISFCNAN
PGLMKDVAKVF
Parent Accession

Related Articles

Pubmed Authors Title Journal
9037188 Suphioglu,C.; Ferreira,F.; Knox,R.B. Molecular cloning and immunological characterisation of Cyn d 7, a novel calcium-binding allergen from Bermuda grass pollen FEBS Lett. 402 (2-3), 167-172 (1997)
9363908 Smith PM; Xu H; Swoboda I; Singh MB Identification of a Ca2+ binding protein as a new Bermuda grass pollen allergen Cyn d 7: IgE cross-reactivity with oilseed rape pollen allergen Bra r 1. Int Arch Allergy Immunol. 1997 Nov;114(3):265-71