Allergen

CAA23711.1

Accession CAA23711.1
Species Gallus gallus
Common Name Chicken
Description Lysozyme
IUIS Name Gal d 4
Gi 0000063581
Length 147
Year Adopted 2015
Sequence >CAA23711.1 Allergen Gal d 4; lysozyme [Gallus gallus]
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCVAKFESNFNTQA
TNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDG
NGMSAWVAWRNRCKGTDVQAWIRGCRL
Parent Accession