Allergen

CAA62911.1

Accession CAA62911.1
External DB Link NCBI Protein
Species Sinapis alba
Common Name white mustard
Description 2S albumin, conglutin
IUIS Name Sin a 1
Length 145
Year Adopted 2007
Sequence >CAA62911.1 Sin a 1; 2S albumin, conglutin [Sinapis alba]
PAGPFGIPKCRKEFQQAQHLRACQQWLHKQAMQSGSGPSWTLDDEFDFEDDMENPQGPQQ
RPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQVRQQLGQQGQQGPQVQHVISRIYQTA
THLPKVCNIPQVSVCPFKKTMPGPS
Parent Accession

Related Articles

Pubmed Authors Title Journal
7688955 Monsalve,R.I.; Gonzalez de la Pena,M.A.; Menendez-Arias,L.; Lopez-Otin,C.; Villalba,M.; Rodriguez,R. Characterization of a new oriental-mustard (Brassica juncea) allergen, Bra j IE: detection of an allergenic epitope Biochem. J. 293 (PT 3), 625-632 (1993)
8093997 Gonzalez de la Pena,M.A.; Villalba,M.; Garcia-Lopez,J.L.; Rodriguez,R. Cloning and expression of the major allergen from yellow mustard seeds, Sin a I Biochem. Biophys. Res. Commun. 190 (2), 648-653 (1993)
8647131 Gonzalez De La Pena MA; Monsalve RI; Batanero E; Villalba M; Rodriguez R Expression in Escherichia coli of Sin a 1, the major allergen from mustard. Eur J Biochem. 1996 May 1;237(3):827-32
15785078 Palomares O; Cuesta-Herranz J; Rodriguez R; Villalba M A recombinant precursor of the mustard allergen Sin a 1 retains the biochemical and immunological features of the heterodimeric native protein. Int Arch Allergy Immunol. 2005 May;137(1):18-26
3181153 Menendez-Arias L; Moneo I; Dominguez J; Rodriguez R Primary structure of the major allergen of yellow mustard (Sinapis alba L.) seed, Sin a I. Eur J Biochem. 1988 Oct 15;177(1):159-66
18775058 Poikonen S; Rancé F; Puumalainen T; Le Manach G; Reunala T; Turjanmaa K Sensitization and allergy to turnip rape: a comparison between the Finnish and French children with atopic dermatitis. Acta Paediatr. 2008 Sep 4;
21349575 Vereda A; Sirvent S; Villalba M; Rodríguez R; Cuesta-Herranz J; Palomares O Improvement of mustard (Sinapis alba) allergy diagnosis and management by linking clinical features and component-resolved approaches. J Allergy Clin Immunol. 2011 May;127(5):1304-7