Allergen

CAA76831.1

Accession CAA76831.1
External DB Link NCBI Protein
Species Alnus glutinosa
Common Name alder
Description calcium-binding protein, polcalcin
IUIS Name Aln g 4
Length 85
Year Adopted 2007
Sequence >CAA76831.1 Aln g 4; calcium-binding protein, polcalcin [Alnus glutinosa]
MADDHPQDQAEHERIFKCFDANGDGKISASELGDALKTLGSVTPDEVKHMMAEIDTDGDG
FISFQEFTNFARANRGLVKDVAKIF
Parent Accession

Related Articles

Pubmed Authors Title Journal
9862740 Hayek,B.; Vangelista,L.; Pastore,A.; Sperr,W.R.; Valent,P.; Vrtala,S.; Niederberger,V.; Twardosz,A.; Kraft,D.; Valenta,R. Molecular and immunologic characterization of a highly cross-reactive two EF-hand calcium-binding alder pollen allergen, Aln g 4: structural basis for calcium-modulated IgE recognition J. Immunol. 161 (12), 7031-7039 (1998)