Allergen

CAA96548.1

Accession CAA96548.1
External DB Link NCBI Protein
Species Corylus avellana
Common Name European hazelnut
Description pathogenesis related protein, PR-10, Bet v 1-like
IUIS Name Cor a 1
Length 160
Year Adopted 2007
Sequence >CAA96548.1 Cor a 1; pathogenesis related protein, PR-10, Bet v 1-like [Corylus avellana]
MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFS
EGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNK
YHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN
Parent Accession

Related Articles

Pubmed Authors Title Journal
11750653 Luttkopf,D.; Muller,U.; Skov,P.S.; Ballmer-Weber,B.K.; Wuthrich,B.; Skamstrup Hansen,K.; Poulsen,L.K.; Kastner,M.; Haustein,D.; Vieths,S. Comparison of four variants of a major allergen in hazelnut (Corylus avellana) Cor a 1.04 with the major hazel pollen allergen Cor a 1.01 Mol. Immunol. 38 (7), 515-525 (2002)
7916686 Breiteneder,H.; Ferreira,F.; Hoffmann-Sommergruber,K.; Ebner,C.; Breitenbach,M.; Rumpold,H.; Kraft,D.; Scheiner,O. Four recombinant isoforms of Cor a I, the major allergen of hazel pollen, show different IgE-binding properties Eur. J. Biochem. 212 (2), 355-362 (1993)
9332353 Hoffmann-Sommergruber,K.; Vanek-Krebitz,M.; Radauer,C.; Wen,J.; Ferreira,F.; Scheiner,O.; Breiteneder,H. Genomic characterization of members of the Bet v 1 family: genes coding for allergens and pathogenesis-related proteins share intron positions Gene 197 (1-2), 91-100 (1997)