Allergen

CAB02160.1

Accession CAB02160.1
Species Betula pendula
Common Name European white birch
Description pathogenesis related protein, PR-10, Bet v 1-like
IUIS Name Bet v 1
Gi 0001542871
Length 160
Year Adopted 2007
Sequence >CAB02160.1 Bet v 1; pathogenesis related protein, PR-10, Bet v 1-like [Betula pendula]
MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFP
EGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNK
YHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Parent Accession