Allergen

CAB03716.1

Accession CAB03716.1
Species Daucus carota
Common Name Carrot
Description pathogenesis-related protein /PR-10 /Bet v 1 -like protein
IUIS Name Dau c 1
Gi 0002154734
Length 154
Year Adopted 2007
Sequence >CAB03716.1 Allergen Dau c 1; pathogenesis-related protein /PR-10 /Bet v 1 -like protein [Daucus carota]
MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDVKGDGGAGTVRIITLPE
GSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAIF
HTKGDAVVPEENIKFADEQNTALFKAIEAYLIAN
Parent Accession