Allergen

CAB53458.1

Accession CAB53458.1
External DB Link NCBI Protein
Species Hevea brasiliensis
Common Name Para rubber tree
Description superoxide dismutase
IUIS Name Hev b 10
Length 205
Year Adopted 2007
Sequence >CAB53458.1 Hev b 10; superoxide dismutase [Hevea brasiliensis]
QTFSLPDLPYDYGALEPAISGEIMQLHHQKHHQTYITNYNKALEQLNDAIEKGDSAAVVK
LQSAIKFNGGGHVNHSIFWKNLAPVREGGGELPHGSLGWAIDADFGSLEKLIQLMNAEGV
ALQGSGWVWLALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPD
YLKNIWKVMNWKYASEVYAKECPSS
Parent Accession

Related Articles

Pubmed Authors Title Journal
11167363 Rihs,H.P.; Chen,Z.; Rozynek,P.; Cremer,R. Allergenicity of rHev b 10 (manganese-superoxide dismutase) Allergy 56 (1), 85-86 (2001)
15627782 Wagner S; Breiteneder H Hevea brasiliensis latex allergens: current panel and clinical relevance. Int Arch Allergy Immunol. 2005 Jan;136(1):90-7
11435728 Wagner S; Sowka S; Mayer C; Crameri R; Focke M; Kurup VP; Scheiner O; Breiteneder H Identification of a Hevea brasiliensis latex manganese superoxide dismutase (Hev b 10) as a cross-reactive allergen. Int Arch Allergy Immunol. 2001 Jun;125(2):120-7