Allergen

CAD20556.1

Accession CAD20556.1
Species Platanus x acerifolia
Common Name London plane tree
Description invertase inhibitor
IUIS Name Pla a 1
Gi 0026190140
Length 179
Year Adopted 2007
Sequence >CAD20556.1 Pla a 1; invertase inhibitor [Platanus x acerifolia]
MKLSFSLCIFFFNLLLLLQAVISADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHTAD
LQGLGVISANLAIQHGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADF
KSKDYASANVKMSAALDDSVTCEDGFKEKKGIVSPVTKENKDYVQLTAISLAITKLLGA
Parent Accession

Related Articles

Pubmed Authors Title Journal
12646046 Calabozo,B.; Diaz-Perales,A.; Salcedo,G.; Barber,D.; Polo,F. Cloning and expression of biologically active Plantago lanceolata pollen allergen Pla l 1 in the yeast Pichia pastoris Biochem. J. 372 (Pt 3), 889-896 (2003)
11251634 Calabozo B; Barber D; Polo F Purification and characterization of the main allergen of Plantago lanceolata pollen, Pla l 1. Clin Exp Allergy. 2001 Feb;31(2):322-30
12569985 Calabozo B; Barber D; Polo F Studies on the carbohydrate moiety of Pla l 1 allergen. identification of a major N-glycan and significance for the immunoglobulin E-binding activity. Clin Exp Allergy. 2002 Nov;32(11):1628-34