Allergen

CAD68071.1

Accession CAD68071.1
Species Malassezia sympodialis
Common Name Yeast
Description Mn superoxide dismutase
IUIS Name Mala s 11
Gi 0028569698
Length 237
Year Adopted 2007
Sequence >CAD68071.1 Allergen Mala s 11; Mn superoxide dismutase [Malassezia sympodialis]
PFYPIPSALPFPLPIHSLFSRRTRLFRFSRTAARAGTEHTLPPLPYEYNALEPFISADIM
MVHHGKHHQTYVNNLNASTKAYNDAVQAQDVLKQMELLTAVKFNGGGHVNHALFWKTMAP
QSQGGGQLNDGPLKQAIDKEFGDFEKFKAAFTAKALGIQGSGWCWLGLSKTGSLDLVVAK
DQDTLTTHHPIIGWDGWEHAWYLQYKNDKASYLKQWWNVVNWSEAESRYSEGLKASL
Parent Accession