Allergen

CAD82912.1

Accession CAD82912.1
External DB Link NCBI Protein
Species Canis familiaris
Common Name dog
Description lipocalin
IUIS Name Can f 2
Length 179
Year Adopted 2007
Sequence >CAD82912.1 Can f 2; lipocalin [Canis familiaris]
QLLLLTVGLALICGLQAQEGNHEEPQGGLEELSGRWHSVALASNKSDLTKPWGHFRVFIH
SMSAKDVNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLIL
YMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD
Parent Accession

Related Articles

Pubmed Authors Title Journal
9497502 Konieczny,A.; Morgenstern,J.P.; Bizinkauskas,C.B.; Lilley,C.H.; Brauer,A.W.; Bond,J.F.; Aalberse,R.C.; Wallner,B.P.; Kasaian,M.T. The major dog allergens, Can f 1 and Can f 2, are salivary lipocalin proteins: cloning and immunological characterization of the recombinant forms Immunology 92 (4), 577-586 (1997)
15479273 Saarelainen S; Taivainen A; Rytkonen-Nissinen M; Auriola S; Immonen A; Mantyjarvi R; Rautiainen J; Kinnunen T; Virtanen T Assessment of recombinant dog allergens Can f 1 and Can f 2 for the diagnosis of dog allergy. Clin Exp Allergy. 2004 Oct;34(10):1576-82
20621650 Madhurantakam,C.; Nilsson,O.B.; Uchtenhagen,H.; Konradsen,J.; Saarne,T.; Hogbom,E.; Sandalova,T.; Gronlund,H.; Achour,A.; Crystal structure of the dog lipocalin allergen Can f 2: implications for cross-reactivity to the cat allergen Fel d 4 J. Mol. Biol. 401 (1), 68-83 (2010)