Allergen

CAI64398.1

Accession CAI64398.1
Species Triticum aestivum
Common Name Wheat
Description 5a2 protein [Triticum aestivum]
IUIS Name
Gi 0066840998
Length 94
Year Adopted 2007
Sequence >CAI64398.1 Putative 5a2 protein [Triticum aestivum]
IAVAVSADECEGDRRAMIKECAKYQQWPANPKLDPSDACCAVWQKANIPCLCAGVTKEKE
KIYCMEKVAYVANFCKKPFPHGYKCGSYTFPPLA
Parent Accession