Allergen

CAM31908.1

Accession CAM31908.1
External DB Link NCBI Protein
Species Actinidia chinensis
Common Name gold kiwifruit
Description pathogenesis related protein, PR-10, Bet v 1-like
IUIS Name Act c 8
Length 159
Year Adopted 2011
Sequence >CAM31908.1 Act c 8; pathogenesis related protein, PR-10, Bet v 1-like [Actinidia chinensis]
MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFG
EGSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSI
YTTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANPDYC
Parent Accession

Related Articles

Pubmed Authors Title Journal
18925615 Oberhuber C; Bulley SM; Ballmer-Weber BK; Bublin M; Gaier S; DeWitt AM; Briza P; Hofstetter G; Lidholm J; Vieths S; Hoffmann-Sommergruber K Characterization of Bet v 1-related allergens from kiwifruit relevant for patients with combined kiwifruit and birch pollen allergy. Mol Nutr Food Res. 2008 Nov;52 Suppl 2:S230-40
20061012 Bublin M; Pfister M; Radauer C; Oberhuber C; Bulley S; Dewitt AM; Lidholm J; Reese G; Vieths S; Breiteneder H; Hoffmann-Sommergruber K; Ballmer-Weber BK Component-resolved diagnosis of kiwifruit allergy with purified natural and recombinant kiwifruit allergens. J Allergy Clin Immunol. 2010 Mar;125(3):687-94, 694.e1