Allergen

CAM56785.1

Accession CAM56785.1
External DB Link NCBI Protein
Species Gadus morhua
Common Name Atlantic cod
Description calcium-binding protein, parvalbumin
IUIS Name Gad m 1
Length 109
Year Adopted 2009
Sequence >CAM56785.1 Gad m 1; calcium-binding protein, parvalbumin [Gadus morhua]
MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE
EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVKA
Parent Accession

Related Articles

Pubmed Authors Title Journal
12431393 van Do,T.; Hordvik,I.; Endresen,C.; Elsayed,S. The major allergen (parvalbumin) of codfish is encoded by at least two isotypic genes: cDNA cloning, expression and antibody binding of the recombinant allergens Mol. Immunol. 39 (10), 595-602 (2003)
16337465 Van Do T; Elsayed S; Florvaag E; Hordvik I; Endresen C Allergy to fish parvalbumins: studies on the cross-reactivity of allergens from 9 commonly consumed fish. J Allergy Clin Immunol. 2005 Dec;116(6):1314-20