Allergen

CBA13560.1

Accession CBA13560.1
External DB Link NCBI Protein
Species Triticum aestivum
Common Name wheat
Description alpha-amylase inhibitor
IUIS Name Tri a 15
Length 121
Year Adopted 2011
Sequence >CBA13560.1 Tri a 15; alpha-amylase inhibitor [Triticum aestivum]
SGPWSWCDPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADVNNEWCRCEDLS
SMLRSVYQELGAREGKEVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCYWAAYPD
V
Parent Accession

Related Articles

Pubmed Authors Title Journal
9494090 Amano,M.; Ogawa,H.; Kojima,K.; Kamidaira,T.; Suetsugu,S.; Yoshihama,M.; Satoh,T.; Samejima,T.; Matsumoto,I.; Identification of the major allergens in wheat flour responsible for baker's asthma Biochem. J. 330 (Pt 3), 1229-1234 (1998)
21557753 Sander I; Rozynek P; Rihs HP; van Kampen V; Chew FT; Lee WS; Kotschy-Lang N; Merget R; Brüning T; Raulf-Heimsoth M Multiple wheat flour allergens and cross-reactive carbohydrate determinants bind IgE in baker Allergy. 2011 Sep;66(9):1208-15