Allergen

CBW45298.1

Accession CBW45298.1
External DB Link NCBI Protein
Species Plodia interpunctella
Common Name Indian meal moth
Description thioredoxin
IUIS Name Plo i 2
Length 106
Year Adopted 2012
Sequence >CBW45298.1 Plo i 2; thioredoxin [Plodia interpunctella]
MSIHIKDVEDLTARLTEAGDKLVVIDFMATWCGPCKIIGPKLDEIAAEMADSIVVVKVDV
DECEDIATEYSINTMPTFVFVKNGKPVEQFSGANVEKLRSTILKLK
Parent Accession

Related Articles

Pubmed Authors Title Journal
11673567 Binder,M.; Mahler,V.; Hayek,B.; Sperr,W.R.; Scholler,M.; Prozell,S.; Wiedermann,G.; Valent,P.; Valenta,R.; Duchene,M. Molecular and immunological characterization of arginine kinase from the Indianmeal moth, Plodia interpunctella, a novel cross-reactive invertebrate pan-allergen J. Immunol. 167 (9), 5470-5477 (2001)
22844539 Hoflehner E; Binder M; Hemmer W; Mahler V; Panzani RC; Jarisch R; Wiedermann U; Duchêne M Thioredoxin from the Indianmeal moth Plodia interpunctella: cloning and test of the allergenic potential in mice. PLoS One. 2012;7(7):e42026