Allergen

COMPARE00280

Accession COMPARE00280
Species Lupinus albus
Common Name white lupine
Description profilin
IUIS Name Lup a 5
Gi
Length 130
Year Adopted 2022
Sequence >COMPARE00280 Allergen Lup a 5; profilin [Lupinus albus]
SWQTYVDEHLLCDIEGNQLTSAAIIGQDGSVWAQSSSFPQFKPEEITAIVNDFAEPGSLA
PTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQALIIGIYDEPMTPGQCNVVVER
LGDYLIDTGL
Parent Accession