Allergen

COMPARE00324

Accession COMPARE00324
Species Prunus dulcis
Common Name almond
Description mandelonitrile lyase 2, partial
IUIS Name Pru du 10
Gi
Length 90
Year Adopted 2022
Sequence >COMPARE00324 Allergen Pru du 10; mandelonitrile lyase 2, partial [Prunus dulcis]
KTAFLEAGVHPNHGFSLDHEEGTRITGSTFDNKGTRHAADELLNKGNSNNLRVGVHASVE
KIIFSNAPGLTATGVIYRDSNGTPHQAFVR
Parent Accession Q945K2