Allergen

COMPARE00324

Accession COMPARE00324
External DB Link
Species Prunus dulcis
Common Name almond
Description mandelonitrile lyase 2, partial from Q945K2.1
IUIS Name Pru du 10
Length 90
Year Adopted 2022
Sequence >COMPARE00324 Pru du 10; mandelonitrile lyase 2, partial from Q945K2.1 [Prunus dulcis]
KTAFLEAGVHPNHGFSLDHEEGTRITGSTFDNKGTRHAADELLNKGNSNNLRVGVHASVE
KIIFSNAPGLTATGVIYRDSNGTPHQAFVR
Parent Accession Q945K2.1

Related Sequences

Peptide sequences mapped to Parent Accession

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.