Allergen

COMPARE00329

Accession COMPARE00329
Species Prunus dulcis
Common Name almond
Description cysteine-rich anti-microbial protein, partial
IUIS Name Pru du 8
Gi
Length 40
Year Adopted 2022
Sequence >COMPARE00329 Allergen Pru du 8; cysteine-rich anti-microbial protein, partial [Prunus dulcis]
REQQEQCQEECTEKIRQLEQCQEGCKMQGQYGPQQQECQR
Parent Accession A0A314YX39