Allergen

COMPARE00329

Accession COMPARE00329
External DB Link
Species Prunus dulcis
Common Name almond
Description cysteine-rich anti-microbial protein, partial from PQQ11123.1
IUIS Name Pru du 8
Length 40
Year Adopted 2022
Sequence >COMPARE00329 Pru du 8; cysteine-rich anti-microbial protein, partial from PQQ11123.1 [Prunus dulcis]
REQQEQCQEECTEKIRQLEQCQEGCKMQGQYGPQQQECQR
Parent Accession PQQ11123.1

Related Sequences

Peptide sequences mapped to Parent Accession

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.