Allergen

COMPARE00332

Accession COMPARE00332
External DB Link
Species Cucurbita maxima
Common Name winter squash
Description 11S globulin, glycinin, cupin, partial from P13744.1
IUIS Name Cuc ma 4
Length 56
Year Adopted 2022
Sequence >COMPARE00332 Cuc ma 4; 11S globulin, glycinin, cupin, partial from P13744.1 [Cucurbita maxima]
EGDLLVVPAGVSHWMYNRGQSDLVLIVFADTRNVANQIDPYLRKFYLAGRPEQVER
Parent Accession P13744.1

Related Sequences

Peptide sequences mapped to Parent Accession

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.