Allergen

COMPARE00332

Accession COMPARE00332
Species Cucurbita maxima
Common Name winter squash
Description 11S globulin, glycinin, cupin, partial
IUIS Name Cuc ma 4
Gi
Length 56
Year Adopted 2022
Sequence >COMPARE00332 Allergen Cuc ma 4; 11S globulin, glycinin, cupin, partial [Cucurbita maxima]
EGDLLVVPAGVSHWMYNRGQSDLVLIVFADTRNVANQIDPYLRKFYLAGRPEQVER
Parent Accession P13744