Allergen

COMPARE00336

Accession COMPARE00336
Species Cucurbita maxima
Common Name winter squash
Description 11S globulin, glycinin, cupin, partial
IUIS Name Cuc ma 4
Gi
Length 46
Year Adopted 2022
Sequence >COMPARE00336 Allergen Cuc ma 4; 11S globulin, glycinin, cupin, partial [Cucurbita maxima]
GVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQSVFDGEVR
Parent Accession P13744