Allergen

COMPARE00525

Accession COMPARE00525
External DB Link
Species Linum usitatissimum
Common Name flax
Description 2S albumin, conlinin, partial from CAC94011.1
IUIS Name Lin u 1
Length 64
Year Adopted 2024
Sequence >COMPARE00525 Lin u 1; 2S albumin, conlinin, partial from CAC94011.1 [Linum usitatissimum]
SYYYNQGRGGGQQSQHFDSCCDDLKQLRSECTCRGLERAIGQMRQDIQQQGQQQEVERWV
QQAK
Parent Accession CAC94011.1

Related Sequences

Peptide sequences mapped to Parent Accession

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.