Allergen

COMPARE00624

Accession COMPARE00624
External DB Link
Species Callinectes bellicosus
Common Name brown crab
Description arginine kinase, partial from UVH30529.1
IUIS Name Cal b 2
Length 40
Year Adopted 2024
Sequence >COMPARE00624 Cal b 2; arginine kinase, partial from UVH30529.1 [Callinectes bellicosus]
TFLVWCNEEDHLRIISMQMGGDLGQVYRRLVSAVNEIEKR
Parent Accession UVH30529.1

Related Sequences

Peptide sequences mapped to Parent Accession

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.