COMPARE00739

Accession COMPARE00739
External DB Link
Species Prunus persica
Common Name peach
Description mandelonitrile lyase, partial from A0A251QUN1
IUIS Name
Length 33
Year Adopted 2025
Sequence >COMPARE00739 mandelonitrile lyase, partial from A0A251QUN1 [Prunus persica]
FNYYSDPVDLTHCVRGMKNVGVFLSTDALKPYK
Parent Accession A0A251QUN1

Related Sequences

Some peptide sequences can be mapped with 100% identity to a full-length parent accession in the NCBI Protein or UniProt database. The parent sequence itself is not present in COMPARE as there is no published data to support its inclusion yet. The black arrow shows the present entry. Related peptide sequences (children) are shown as grey arrows and the parent accession is the green arrow. Clicking the green arrow in the graphic below will link out to NCBI Protein. Clicking a grey arrow will take you to the COMPARE allergen record for that entry.

Warning (2): fopen(/var/www/jifsanit-comparedb-2025/_fastatempfiles/parentaccession-A0A251QUN1.faa): failed to open stream: Permission denied [APP/Template/Allergens/view.ctp, line 138]
Unable to write temporary parent .faa file.