COMPARE00901

Accession COMPARE00901
External DB Link
Species Papaver somniferum
Common Name opium poppy
Description 7S globulin, vicilin, partial from RZC52308.1
IUIS Name Pap s 1
Length 207
Year Adopted 2025
Sequence >COMPARE00901 Pap s 1; 7S globulin, vicilin, partial from RZC52308.1 [Papaver somniferum]
ESYNLKQGDVLRVPVGSLVYMINRDNSETLQIGKILVTVSTPGQVREFFSSGDHEPESFY
RVFSNDILESAFNTPRERLDRLFGQQTQGVIIRASQEQVRELSRHASSSSEEGHFWPKRG
GQSSSGPFNILNKRATYSNSYGQLYEVDGNDYKQLQDLDLGVSFTNISQGGMLGPYYNTR
STKVLLVVEGNGRFEMACPHLSKQSQR
Parent Accession RZC52308.1

Related Sequences

Some peptide sequences can be mapped with 100% identity to a full-length parent accession in the NCBI Protein or UniProt database. The parent sequence itself is not present in COMPARE as there is no published data to support its inclusion yet. The black arrow shows the present entry. Related peptide sequences (children) are shown as grey arrows and the parent accession is the green arrow. Clicking the green arrow in the graphic below will link out to NCBI Protein. Clicking a grey arrow will take you to the COMPARE allergen record for that entry.

Warning (2): fopen(/var/www/jifsanit-comparedb-2025/_fastatempfiles/parentaccession-RZC52308.1.faa): failed to open stream: Permission denied [APP/Template/Allergens/view.ctp, line 138]
Unable to write temporary parent .faa file.