Allergen

COMPARE00902

Accession COMPARE00902
External DB Link
Species Papaver somniferum
Common Name opium poppy
Description 7S globulin, vicilin, partial from RZC52308.1
IUIS Name Pap s 1
Length 110
Year Adopted 2025
Sequence >COMPARE00902 Pap s 1; 7S globulin, vicilin, partial from RZC52308.1 [Papaver somniferum]
GRQEFEEEREQGQGVHYEKVSARLSPRSVFIVPAGHPVAIVASQNQNLQIVAFEINAQGN
QRNFLAGRESVINQMEKVAMELGFNVPSSEVQEILNKQRESFFLPGPNQR
Parent Accession RZC52308.1

Related Sequences

Some peptide sequences can be mapped with 100% identity to a full-length parent accession in the NCBI Protein or UniProt database. The parent sequence itself is not present in COMPARE as there is no published data to support its inclusion yet. The black arrow shows the present entry. Related peptide sequences (children) are shown as grey arrows and the parent accession is the green arrow. Clicking the green arrow in the graphic below will link out to NCBI Protein. Clicking a grey arrow will take you to the COMPARE allergen record for that entry.

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.