Allergen

COMPARE01160

Accession COMPARE01160
External DB Link
Species Cannabis sativa
Common Name hemp
Description oxygen evolving enhancer protein 2, partial from XP_030482568.1
IUIS Name Can s 4
Length 256
Year Adopted 2026
Sequence >COMPARE01160 Can s 4; oxygen evolving enhancer protein 2, partial from XP_030482568.1 [Cannabis sativa]
ALTTAAASARSSSSSSQRQCNIRAPAQLVCRAQKQGTSNDDDSSVVSRRLALTVLIGAAA
LGSKVSPADAAYGETANIFGKPKTNTDFLPYSGDGFKVQIPSKWNPSKEREFPGQVLRYE
DNFDATSNLSVMIIPTEKKSITDYGSPEQFLSQVDFLLGKQAYFGKTDSEGGFDSDAVAT
ANILESSAPVIGGKQYYNLSVLTRTADGDEGGKHQLITATIKDGKLYICKAQAGDKRWFK
GARKFVEDAAGSFSVA
Parent Accession XP_030482568.1

Related Sequences

Some peptide sequences can be mapped with 100% identity to a full-length parent accession in the NCBI Protein or UniProt database. The parent sequence itself is not present in COMPARE as there is no published data to support its inclusion yet. The black arrow shows the present entry. Related peptide sequences (children) are shown as grey arrows and the parent accession is the green arrow. Clicking the green arrow in the graphic below will link out to NCBI Protein. Clicking a grey arrow will take you to the COMPARE allergen record for that entry.

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.