Allergen

COMPARE021

Accession COMPARE021
External DB Link
Species Malus domestica
Common Name apple
Description pathogenesis related protein, PR-10, Bet v 1-like, partial
IUIS Name Mal d 1
Length 37
Year Adopted 2020
Sequence >COMPARE021 Mal d 1; pathogenesis related protein, PR-10, Bet v 1-like, partial [Malus domestica]
GVYTFENEYTSEIPPGRLFKAFVLDADNLIPKIAPQA
Parent Accession

Related Articles

Pubmed Authors Title Journal
7549498 Fahlbusch,B.; Rudeschko,O.; Muller,W.D.; Schlenvoigt,G.; Vettermann,S.; Jager,L. Purification and characterization of the major allergen from apple and its allergenic cross-reactivity with Bet v 1 Int. Arch. Allergy Immunol. 108 (2), 119-126 (1995)