Allergen

COMPARE022

Accession COMPARE022
Species Prunus dulcis
Common Name almond
Description 7S globulin, vicilin, beta-conglutin, partial
IUIS Name
Gi
Length 547
Year Adopted 2020
Sequence >COMPARE022 7S globulin, vicilin, beta-conglutin, partial [Prunus dulcis]
MAIKITIKASYKLPFFFFFLSTLFLASSSVTPLINALSDYHNQKCQQSICRGVGGRHSLL
RSKDHPQDAREEYFYCSQSCGTSEDPEQCETECRERFDEQLKKEAEEQQKGQEEEEEEGP
TFNPNPYYFPKFGLRPRFLAEEGAYFVLGSFARLSHLLRGRIQNYRAALLQTTPGTFVLP
YHLDAESIFVVWNGRGTLTLVMKDTKQSFKIENGDVIRVPAGATTYLINNHTTENLSLVQ
LFQPVNTPDLFEEFFPAGYKDPEPGSDYSFLHGTESYYSVFSNDLLEAAFDVPREQLEKA
FGQQKREGMIIRASKEQLDALSKQAYPWWRKLVPWSMGSDLNFNLLSQRPLHSNNYGKFY
EASPQEFKQLQDMNVSVAMLDINPEAMMVPHYNSKATYLMMVVDGMGYFEMACPKFTIPA
SEEEMEYQEEQADQQSGVFSKVSGKLSLGDVFVIPAGHPVSIVAQNNNNNNNNNGNQNQK
LRIVGFGINAGNNIRNFLAGQEGNIMKQMEREATQLTFGQEMEQVLTSQKQSYFVPASRR
GSSTEKA
Parent Accession QFG58557.1