Allergen

COMPARE028

Accession COMPARE028
Species Lathyrus sativus
Common Name chickling vetch, white pea
Description 7S globulin, vicilin
IUIS Name
Gi
Length 368
Year Adopted 2020
Sequence >COMPARE028 7S globulin, vicilin [Lathyrus sativus]
YRLLEYKSKPHTLFLPQYTDADFILVVLSGKAILTVLNSNDRNSFSLERGDTIKIPAGTI
AYLANRDDNEDLRVLDLAIPVNKPGQLQPFLLSGTQNQPSLLSGFSKKVLEAAFNTNYEE
IEKVLLEQQEQQHRRSLKDRRQEINEENVIVKVSREQIEELSKNAKSSSKKSVSSESEPF
NLRSRNPIYSNKFGKFFEITPEKNQQLQDLDIFVNSVEIKEGSLLLPNYNSRAIVIVTVN
EGKGDFELLGIRNENQREESDEEEEQEEETSKQVQRYRAKLSPGDVFVIPAGHPVAINAS
SNLNLIGFGINAENNQRNFLAGEEDNVISQIQRPVKELVFPGSSREVDKLLKNQRQSYFA
NAQPLQRE
Parent Accession