Allergen

COMPARE0339

Accession COMPARE0339
External DB Link
Species Artemisia absinthium
Common Name absinthe wormwood
Description defensin, partial from AHF71021.1
IUIS Name Art ab 1
Length 55
Year Adopted 2021
Sequence >COMPARE0339 Art ab 1; defensin, partial from AHF71021.1 [Artemisia absinthium]
AGSKLCEKTSKTWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSK
Parent Accession AHF71021.1
Notes previous accession was AHF71021.1A

Related Sequences

Peptide sequences mapped to Parent Accession

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.