Allergen

COMPARE0340

Accession COMPARE0340
External DB Link
Species Artemisia annua
Common Name sweet wormwood
Description defensin, partial from AHF71022.1
IUIS Name Art an 1
Length 44
Year Adopted 2021
Sequence >COMPARE0340 Art an 1; defensin, partial from AHF71022.1 [Artemisia annua]
TWSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSK
Parent Accession AHF71022.1

Related Sequences

Peptide sequences mapped to Parent Accession

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.