Allergen

COMPARE0341

Accession COMPARE0341
External DB Link
Species Artemisia californica
Common Name California sagebrush
Description defensin, partial from AHF71023.1
IUIS Name Art c 1
Length 39
Year Adopted 2021
Sequence >COMPARE0341 Art c 1; defensin, partial from AHF71023.1 [Artemisia californica]
CDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSK
Parent Accession AHF71023.1

Related Sequences

Peptide sequences mapped to Parent Accession

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.