Allergen

COMPARE0347

Accession COMPARE0347
External DB Link
Species Gadus chalcogrammus
Common Name walleye pollock
Description vitellogenin, partial from BAM22586.1
IUIS Name
Length 274
Year Adopted 2021
Sequence >COMPARE0347 vitellogenin, partial from BAM22586.1 [Gadus chalcogrammus]
QVYEAQCSYAKNTLTTFNNRRYKNEMPLSCNQVLAQDCSKELKFMVLLKKDNIE
QNWINVKLADIDIDLYPENDNMIVKVNGMQIPISNLPYQHPTGTIQIKSNGEGI
SVYAASHGLHEVYFDRSSWKVKLADWMKGQTCGICGKADGEVRQEFRTPNGQLA
KDAVSYAHSWVIPAENCQDASECRMRQESVKLEKQIMVHGQESNCHSVETVLRC
LPGCIPVKTTPVTVGFHCLPISAEQQRSGDLSSVLEQSVDLRESVMAHLACNCA
NLCA
Parent Accession BAM22586.1

Related Sequences

Some peptide sequences can be mapped with 100% identity to a full-length parent accession in the NCBI Protein or UniProt database. The parent sequence itself is not present in COMPARE as there is no published data to support its inclusion yet. The black arrow shows the present entry. Related peptide sequences (children) are shown as grey arrows and the parent accession is the green arrow. Clicking the green arrow in the graphic below will link out to NCBI Protein. Clicking a grey arrow will take you to the COMPARE allergen record for that entry.

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.

Related Articles

Pubmed Authors Title Journal
31708435 Hanaoka, K., Takahagi, S., Ishii, K., Nakano, M., Chinuki, Y., Tanaka, A., Yanase, Y., & Hide, M. Type-I-hypersensitivity to 15 kDa, 28 kDa and 54 kDa proteins in vitellogenin specific to Gadus chalcogrammus roe. Allergol Int. 2020;69(2):253-260.