Allergen

COMPARE073

Accession COMPARE073
Species Ascaris lumbricoides
Common Name parasitic roundworm
Description glutathione S-transferase, partial
IUIS Name Asc l 13
Gi
Length 68
Year Adopted 2020MS
Sequence >COMPARE073 Asc l 13; glutathione S-transferase, partial [Ascaris lumbricoides]
RLIFHQAGVKFEDNRLKREDWPALKPKTPFGQPLLEVDGEVLAQSAAIYR
Parent Accession