Allergen

COMPARE074

Accession COMPARE074
Species Ascaris lumbricoides
Common Name parasitic roundworm
Description glutathione S-transferase, partial
IUIS Name Asc l 13
Gi
Length 65
Year Adopted 2020MS
Sequence >COMPARE074 Asc l 13; glutathione S-transferase, partial [Ascaris lumbricoides]
FGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKVLKEVAVPARDKHLP
LLEK
Parent Accession