Allergen

COMPARE089

Accession COMPARE089
External DB Link
Species Aedes aegypti
Common Name yellow fever mosquito
Description calcium-binding protein, sarcoplasmic calcium-binding protein, partial from Q16XK7
IUIS Name Aed a 5
Length 16
Year Adopted 2020
Sequence >COMPARE089 Aed a 5; calcium-binding protein, sarcoplasmic calcium-binding protein, partial from Q16XK7 [Aedes aegypti]
KVDDSYNQLVSDEDNK
Parent Accession Q16XK7

Related Sequences

Some peptide sequences can be mapped with 100% identity to a full-length parent accession in the NCBI Protein or UniProt database. The parent sequence itself is not present in COMPARE as there is no published data to support its inclusion yet. The black arrow shows the present entry. Related peptide sequences (children) are shown as grey arrows and the parent accession is the green arrow. Clicking the green arrow in the graphic below will link out to NCBI Protein. Clicking a grey arrow will take you to the COMPARE allergen record for that entry.

MSYPWEKRVEFIVGHMYDIDNNGFLDNNDFMCMALRATVVEGKGTINPARLNEYRTIMKALWDEISALADLDHDGKITTEEFKDAVKATCVGKSYSDFPKAMKAFIDAHYQMMDINNDGLVSIEEYRYNCISRIAMDDIKKVDDSYNQLVSDEDNKRGGITLQRYQELYAQFMGNESDKCAAIFLYGPIPE20406080100120140160180COMPARE090COMPARE087COMPARE089COMPARE091COMPARE088Q16XK7COMPARE090COMPARE087COMPARE089COMPARE091COMPARE088

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.