Allergen

COMPARE215

Accession COMPARE215
Species Exopalaemon modestus
Common Name White legged freshwater shrimp
Description tropomyosin
IUIS Name Exo m 1
Gi
Length 284
Year Adopted 2021
Sequence >COMPARE215 Allergen Exo m 1; tropomyosin [Exopalaemon modestus]
MDAIKKKMQAMKLEKDNAMDRALTCEQQNKEANNRAEKSEEEVHNLQ
KRMQQLENDLDSVQEALLKANAHLEEKDKALSNAEGEVAALNRRIQL
LEEDLERSEERLNTATTKLAEASQAADESERMRKVLENRSLSDEERM
DALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGES
KIVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAA
EARAEFAERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTFSELS
GY
Parent Accession