Allergen

COMPARE239

Accession COMPARE239
External DB Link
Species Prunus persica
Common Name peach
Description pathogenesis related protein, PR-1, partial from XP_007199020.1
IUIS Name Pru p 9
Length 34
Year Adopted 2021
Sequence >COMPARE239 Pru p 9; pathogenesis related protein, PR-1, partial from XP_007199020.1 [Prunus persica]
TTEVGCGISKCNNGQNYVVCSYDPMYQPEDERPY
Parent Accession XP_007199020.1

Related Sequences

Peptide sequences mapped to Parent Accession

To zoom in, left-click and drag the mouse pointer to the right: left-click on the desired start point, hold the mouse button, move the mouse to the desired end point (to the right) and let go. Zoom back out by right-clicking.