Allergen

NP_001306883

Accession NP_001306883
External DB Link NCBI Protein
Species Solanum lycopersicum
Common Name tomato
Description lipid transfer protein
IUIS Name Sola l 6
Length 96
Year Adopted 2016
Sequence >NP_001306883 Sola l 6; lipid transfer protein [Solanum lycopersicum]
MKMTKVCSFVAVMLVMILVCDQFGANEAATCSASQLSPCLGAIQGGTAPSQDCCARLKNQ
QPCICGFMKDPNLRQYVNSPNARKVAGQCGVSIPSC
Parent Accession
Notes This entry was previously assigned accession XP_004232333.1 in COMPARE 2019 and older versions. This accession is now obsolete on NCBI and replaced by NP_001306883. Current accession reflects this change. (January 2020)

Related Articles

Pubmed Authors Title Journal
25791776 Giangrieco I; Alessandri C; Rafaiani C; Santoro M; Zuzzi S; Tuppo L; Tamburrini M; D Structural features, IgE binding and preliminary clinical findings of the 7kDa Lipid Transfer Protein from tomato seeds. Mol Immunol. 2015 Aug;66(2):154-63