Allergen

O04004.1

Accession O04004.1
External DB Link NCBI Protein
Species Ambrosia artemisiifolia
Common Name short ragweed
Description lipid transfer protein
IUIS Name Amb a 6
Length 118
Year Adopted 2007
Sequence >O04004.1 Amb a 6; lipid transfer protein [Ambrosia artemisiifolia]
MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFLTGQEPSKACCTGVNNL
NNSRKTKADRVAVCNCIKELTKSIAYDPKRMPLLSTKCGVKPDFPAVDKNLDCSKLPV
Parent Accession

Related Articles

Pubmed Authors Title Journal
9714407 Hiller,K.M.; Lubahn,B.C.; Klapper,D.G. Cloning and expression of ragweed allergen Amb a 6 Scand. J. Immunol. 48 (1), 26-36 (1998)
6863927 Roebber,M.; Hussain,R.; Klapper,D.G.; Marsh,D.G. Isolation and properties of a new short ragweed pollen allergen, Ra6 J. Immunol. 131 (2), 706-711 (1983)