Allergen

P00698.1

Accession P00698.1
External DB Link NCBI Protein
Species Gallus gallus
Common Name chicken
Description lysozyme
IUIS Name Gal d 4
Length 147
Year Adopted 2007
Sequence >P00698.1 Gal d 4; lysozyme [Gallus gallus]
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQA
TNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDG
NGMNAWVAWRNRCKGTDVQAWIRGCRL
Parent Accession

Related Articles

Pubmed Authors Title Journal
6601671 Hoffman DR Immunochemical identification of the allergens in egg white. J Allergy Clin Immunol. 1983 May;71(5):481-6
6638415 Langeland T A clinical and immunological study of allergy to hen Allergy. 1983 Oct;38(7):493-500
8507154 Yamada T; Yamada M; Sasamoto K; Nakamura H; Mishima T; Yasueda H; Shida T; Iikura Y [Specific IgE antibody titers to hen Arerugi. 1993 Feb;42(2):136-41