Allergen

P80207.1

Accession P80207.1
External DB Link NCBI Protein
Species Brassica juncea
Common Name mustard
Description 2S albumin, conglutin
IUIS Name Bra j 1
Length 129
Year Adopted 2009
Sequence >P80207.1 Bra j 1; 2S albumin, conglutin [Brassica juncea]
AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQPQGPQQRPPLLQQCCNELHQEE
PLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTATHLPRVCNIPRVSICP
FQKTMPGPS
Parent Accession

Related Articles

Pubmed Authors Title Journal
7688955 Monsalve,R.I.; Gonzalez de la Pena,M.A.; Menendez-Arias,L.; Lopez-Otin,C.; Villalba,M.; Rodriguez,R. Characterization of a new oriental-mustard (Brassica juncea) allergen, Bra j IE: detection of an allergenic epitope Biochem. J. 293 (PT 3), 625-632 (1993)
9249277 Monsalve RI; Gonzalez de la Pena MA; Lopez-Otin C; Fiandor A; Fernandez C; Villalba M; Rodriguez R Detection, isolation and complete amino acid sequence of an aeroallergenic protein from rapeseed flour. Clin Exp Allergy. 1997 Jul;27(7):833-41
12708976 Morisset M; Moneret-Vautrin DA; Maadi F; Frémont S; Guénard L; Croizier A; Kanny G Prospective study of mustard allergy: first study with double-blind placebo-controlled food challenge trials (24 cases). Allergy. 2003 Apr;58(4):295-9
12708974 Rancé F Mustard allergy as a new food allergy. Allergy. 2003 Apr;58(4):287-8
18775058 Poikonen S; Rancé F; Puumalainen T; Le Manach G; Reunala T; Turjanmaa K Sensitization and allergy to turnip rape: a comparison between the Finnish and French children with atopic dermatitis. Acta Paediatr. 2008 Sep 4;