Allergen

P84527.2

Accession P84527.2
Species Actinidia deliciosa
Common Name green kiwifruit
Description kiwellin
IUIS Name Act d 5
Gi
Length 213
Year Adopted 2022
Sequence >P84527.2 Allergen Act d 5; kiwellin [Actinidia deliciosa]
MAQLALLLLSLFLTLISLAPPGASISSCNGPCRDLNDCDGQLICIKGKCNDDPQVGTHIC
RGTTPSPQPGGCKPSGTLTCRGKSYPTYDCSPPVTSSTPAKLTNNDFSEGGDDGGPSECD
ESYHNNNERIVALSTGWYNGGSRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQP
PCRNNIVDGSNAVWSALGLDKNVGVVDITWSMA
Parent Accession