Allergen

P86686.1

Accession P86686.1
External DB Link NCBI Protein
Species Polybia paulista
Common Name wasp
Description unknown function, antigen 5
IUIS Name Poly p 5
Length 207
Year Adopted 2012
Sequence >P86686.1 Poly p 5; unknown function, antigen 5 [Polybia paulista]
NKYCNIKCSKVAHTVCQTGESTKPSSKNCAKVSITSVGVTEEEKKLIVDEHNRFRQKVAQ
GLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYS
ASTAAYPGVVKLIVLWENEVKDFNYNTGITKENFAKVGHYTQVVWAKTKEVGCGSIKYIE
KGMKSHYLVCNYGPAGNVLGAQIYEIK
Parent Accession

Related Articles

Pubmed Authors Title Journal
20540563 dos Santos LD; Santos KS; Pinto JR; Dias NB; de Souza BM; dos Santos MF; Perales J; Domont GB; Castro FM; Kalil JE; Palma MS Profiling the proteome of the venom from the social wasp Polybia paulista: a clue to understand the envenoming mechanism. J Proteome Res. 2010 Aug 6;9(8):3867-77
24308509 Dos Santos-Pinto JR, Dos Santos LD, Andrade Arcuri H, Castro FM, Kalil JE, Palma MS Using proteomic strategies for sequencing and post-translational modifications assignment of antigen-5, a major allergen from the venom of the social wasp Polybia paulista. J Proteome Res. 2014;13(2):855-865.