Allergen

P86809.1

Accession P86809.1
External DB Link NCBI Protein
Species Apium graveolens
Common Name celery
Description lipid transfer protein
IUIS Name Api g 6
Length 67
Year Adopted 2015
Sequence >P86809.1 Api g 6; lipid transfer protein [Apium graveolens]
ATCSAVQLSPCLAAITKNTPPSAACCNKLKEQKPCLCGYLKDPNLKNYVNSPGARKTASS
CGVALKC
Parent Accession

Related Articles

Pubmed Authors Title Journal
23913675 Vejvar,E.; Himly,M.; Briza,P.; Eichhorn,S.; Ebner,C.; Hemmer,W.; Ferreira,F.; Gadermaier,G.; Allergenic relevance of nonspecific lipid transfer proteins 2: Identification and characterization of Api g 6 from celery tuber as representative of a novel IgE-binding protein family Mol Nutr Food Res 57 (11), 2061-2070 (2013)