Allergen

QDH76468.1

Accession QDH76468.1
Species Scylla paramamosain
Common Name Green mud crab
Description myosin light chain
IUIS Name Scy p 3
Gi
Length 153
Year Adopted 2021
Sequence >QDH76468.1 Allergen Scy p 3; myosin light chain [Scylla paramamosain]
MAADLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEK
VGGKTKKKEKMLKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTM
LYAELEHILLSLGERLEKSELEPVLKDCCDEEDEDGFIPYEPFLKKLTQLL
Parent Accession