Allergen

QGS84240.1

Accession QGS84240.1
Species Quercus ilex
Common Name holly oak
Description pathogenesis related protein, PR-10, Bet v 1-like protein
IUIS Name Que i 1
Gi
Length 159
Year Adopted 2022
Sequence >QGS84240.1 Allergen Que i 1; pathogenesis related protein, PR-10, Bet v 1-like protein [Quercus ilex]
MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFG
EASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMVSVSTEIKFVASPDGGSIKKSTTKY
QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHPDLYT
Parent Accession